Iright
BRAND / VENDOR: Proteintech

Proteintech, 27105-1-AP, Cytokeratin 8 Polyclonal antibody

CATALOG NUMBER: 27105-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cytokeratin 8 (27105-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 27105-1-AP targets Cytokeratin 8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human tonsillitis tissue, human colon tissue, mouse skin tissue, rat skin tissue, human brown diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT8 is often paired with keratin 18 in vivo. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25844 Product name: Recombinant human KRT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-50 aa of BC008200 Sequence: EGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSL Predict reactive species Full Name: keratin 8 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC008200 Gene Symbol: Cytokeratin 8 Gene ID (NCBI): 3856 RRID: AB_2918117 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05787 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924