Product Description
Size: 20ul / 150ul
The eNOS (27120-1-AP) by Proteintech is a Polyclonal antibody targeting eNOS in WB, ELISA applications with reactivity to human, mouse samples
27120-1-AP targets eNOS in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: bEnd.3 cells, HUVEC cells, mouse liver tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Background Information
Endothelial NOS(eNOS), also known as nitric oxide synthase 3(NOS3), has a protective function in the cardiovascular system, which is attributed to NO production. NOS3 has 3 isoforms of 68, 69, 133 kDa. Polymorphisms in NOS3 gene affects the susceptibility to several diseases such as hypertension, preeclampsia, diabetes mellitus, obesity, erectile dysfunction, and migraine.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse, rat, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25712 Product name: Recombinant human NOS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of Sequence: MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP Predict reactive species
Full Name: nitric oxide synthase 3 (endothelial cell)
Observed Molecular Weight: 133 kDa, 69 kDa
Gene Symbol: eNOS
Gene ID (NCBI): 4846
RRID: AB_2880764
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P29474
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924