Proteintech, 27123-1-AP, DMXL2 Polyclonal antibody

Size: 20ul / 150ul The DMXL2 (27123-1-AP) by Proteintech is a Polyclonal antibody targeting DMXL2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27123-1-AP targets DMXL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells, mouse brain tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DMXL2, also named as rabconnectin-3, is a functional regulator of mammalian notch signaling with WD domains. Rabconnectin-3 is abundantly expressed in the brain where it is enriched in the synaptic vesicle fraction. Immunofluorescence and immunoelectron microscopy revealed that rabconnectin-3 was concentrated on synaptic vesicles at synapses. It may serve as a scaffold molecule for both Rab3 GEP and GAP on synaptic vesicles. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25953 Product name: Recombinant human DMXL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1853-2040 aa of BC140781 Sequence: RNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLTPQEEDDPEGDTEVDVIAE Predict reactive species Full Name: Dmx-like 2 Calculated Molecular Weight: 3036 aa, 340 kDa Observed Molecular Weight: 340 kDa GenBank Accession Number: BC140781 Gene Symbol: DMXL2 Gene ID (NCBI): 23312 RRID: AB_3085927 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.