Proteintech, 27138-1-AP, FCGR2A / CD32a Polyclonal antibody

Size: 20ul / 150ul The FCGR2A / CD32a (27138-1-AP) by Proteintech is a Polyclonal antibody targeting FCGR2A / CD32a in WB, IHC, ELISA applications with reactivity to human samples 27138-1-AP targets FCGR2A / CD32a in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells, Raji cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information IgG Fc receptors (FcγRs) play important roles in immune responses. Low affinity IgG Fc receptor Fc gamma RIIa (FCGR2A, CD32a) is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25878 Product name: Recombinant human FCGR2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-215 aa of BC020823 Sequence: LEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPM Predict reactive species Full Name: Fc fragment of IgG, low affinity IIa, receptor (CD32) Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC020823 Gene Symbol: CD32a Gene ID (NCBI): 2212 RRID: AB_2880770 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12318 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.