Proteintech, 27146-1-AP, NEK1 Polyclonal antibody

Size: 20ul / 150ul The NEK1 (27146-1-AP) by Proteintech is a Polyclonal antibody targeting NEK1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 27146-1-AP targets NEK1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-12 cells, mouse pancreas tissue, HeLa cells Positive IP detected in: PC-12 cells, HeLa cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25970 Product name: Recombinant human NEK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 557-740 aa of BC114491 Sequence: KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD Predict reactive species Full Name: NIMA (never in mitosis gene a)-related kinase 1 Calculated Molecular Weight: 1258 aa, 143 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: BC114491 Gene Symbol: NEK1 Gene ID (NCBI): 4750 RRID: AB_2880773 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.