Proteintech, 27154-1-AP, Factor XII Polyclonal antibody

Size: 20ul / 150ul The Factor XII (27154-1-AP) by Proteintech is a Polyclonal antibody targeting Factor XII in WB, IHC, ELISA applications with reactivity to human samples 27154-1-AP targets Factor XII in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, K-562 cells, HepG2 cells, Jurkat cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Factor XII (F XII, Hageman factor) is a 80kD, single chain glycoprotein that circulates in blood as an inactive zymogen. F XII plays an important role in blood coagulation, fibrinolysis, and kinin generation. Factor XII is activated by kallikrein in alpha-factor XIIa, which is further converted by trypsin into beta-factor XIIa. Alpha-factor XIIa is composed of a 52 kDa NH2-terminal heavy chain, called coagulation factor XIIa heavy chain, and a 28 kDa COOH-terminal light chain, called coagulation factor XIIa light chain, connected by a disulfide bond. Beta-factor XIIa is composed of 2 chains linked by a disulfide bond, an N-terminal nonapeptide, called beta-factor XIIa part 1, and coagulation factor XIIa light chain, also known in this context as beta-factor XIIa part 2. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25912 Product name: Recombinant human F12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 413-500 aa of BC012390 Sequence: CLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLC Predict reactive species Full Name: coagulation factor XII (Hageman factor) Calculated Molecular Weight: 615 aa, 68 kDa Observed Molecular Weight: 80 kDa and 52 kDa GenBank Accession Number: BC012390 Gene Symbol: Factor XII Gene ID (NCBI): 2161 RRID: AB_2880778 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00748 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.