Proteintech, 27159-1-AP, TBXA2R Polyclonal antibody

Size: 20ul / 150ul The TBXA2R (27159-1-AP) by Proteintech is a Polyclonal antibody targeting TBXA2R in WB, IHC, ELISA applications with reactivity to human, mouse samples 27159-1-AP targets TBXA2R in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, DU 145 cells, human placenta tissue, MCF-7 cells, PC-3 cells, Hela cells Positive IHC detected in: human prostate cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TBXA2R, also named as thromboxane A2 receptor, TXA2-R and Prostanoid TP receptor, belongs to G-protein coupled receptor 1 family. Thromboxane A2 receptor is a key molecule in hemostasis as its abnormality leads to bleeding disorders. The TXA2-R receptor is linked via a guanine nucleotide-binding protein (G protein) to phospholipase C (PLC), which hydrolyses phosphoinositides to the two potent stimulatory second messengers inositol 1,4,5-triphosphate (IP3) and diacylglycerol. IP3 causes increases in cytoplasmic free calcium and diacylglycerol causes activation of protein kinase C. In the kidney, the binding of TXA2-R to glomerular TP receptors causes intense vasoconstriction. The two isoforms expressed in cultured cells show similar ligand binding characteristics and phospholipase C (PLC) activation but oppositely regulate adenylyl cyclase activity (PMID: 8613548). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25670 Product name: Recombinant human TBXA2R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC074750 Sequence: MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCR Predict reactive species Full Name: thromboxane A2 receptor Calculated Molecular Weight: 343aa,37 kDa; 1043aa,113 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC074750 Gene Symbol: TBXA2R Gene ID (NCBI): 6915 RRID: AB_2880782 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.