Proteintech, 27166-1-AP, GJB5 Polyclonal antibody

Size: 20ul / 150ul The GJB5 (27166-1-AP) by Proteintech is a Polyclonal antibody targeting GJB5 in IP, ELISA applications with reactivity to human, mouse samples 27166-1-AP targets GJB5 in IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse skin tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information GJB5, also known as Connexin31.1, is a connexin subtype associated with apoptosis in organs such as the eye and ovary; it is not highly expressed in many tissues in normal conditions (PMID:32592185). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26052 Product name: Recombinant human GJB5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-273 aa of BC004379 Sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL Predict reactive species Full Name: gap junction protein, beta 5, 31.1kDa Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC004379 Gene Symbol: GJB5 Gene ID (NCBI): 2709 RRID: AB_3085930 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95377 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.