Proteintech, 27167-1-AP, MRP4 Polyclonal antibody

Size: 20ul / 150ul The MRP4 (27167-1-AP) by Proteintech is a Polyclonal antibody targeting MRP4 in WB, ELISA applications with reactivity to human samples 27167-1-AP targets MRP4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 37°C incubated HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information MRP4 (also known as ABCC4), belonging to ATP-binding cassette (ABC) transporter family, is a multi-transmembrane protein that is able to transport a range of organic anionic compounds (both endogenous and xenobiotic) out of the cell. It can exclude various drugs thus is considered as potential target to prevent drug-resistance. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25937 Product name: Recombinant human ABCC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 567-709 aa of BC041560 Sequence: AEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGA Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 4 Calculated Molecular Weight: 859 aa, 97 kDa Observed Molecular Weight: 150-180 kDa GenBank Accession Number: BC041560 Gene Symbol: MRP4 Gene ID (NCBI): 10257 RRID: AB_3085931 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15439 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.