Product Description
Size: 20ul / 150ul
The CD90 (27178-1-AP) by Proteintech is a Polyclonal antibody targeting CD90 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples
27178-1-AP targets CD90 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Applications
Positive WB detected in: pig brain tissue, mouse brain tissue, rat brain tissue
Positive IHC detected in: human colon cancer tissue, human lung cancer tissue, mouse spleen tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.
Specification
Tested Reactivity: human, mouse, rat, pig
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25603 Product name: Recombinant human CD90 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-80 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF Predict reactive species
Full Name: Thy-1 cell surface antigen
Calculated Molecular Weight: 161 aa, 18 kDa
Observed Molecular Weight: 26 kDa
GenBank Accession Number: BC065559
Gene Symbol: CD90/Thy1
Gene ID (NCBI): 7070
RRID: AB_3085933
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P04216
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924