Proteintech, 27191-1-AP, SOCS4 Polyclonal antibody

Size: 20ul / 150ul The SOCS4 (27191-1-AP) by Proteintech is a Polyclonal antibody targeting SOCS4 in WB, ELISA applications with reactivity to human, mouse samples 27191-1-AP targets SOCS4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SOCS4 contains a SH2 domain and a SOCS BOX domain, and belongs to Suppressors of cytokine signaling (SOCS) family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25887 Product name: Recombinant human SOCS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC060790 Sequence: MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPS Predict reactive species Full Name: suppressor of cytokine signaling 4 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC060790 Gene Symbol: SOCS4 Gene ID (NCBI): 122809 RRID: AB_3669587 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.