Proteintech, 27194-1-AP, CCDC8 Polyclonal antibody

Size: 20ul / 150ul The CCDC8 (27194-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC8 in WB, IP, IHC, ELISA applications with reactivity to human samples 27194-1-AP targets CCDC8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Coiled-coil domain-containing protein 8 (CCDC8) is a 538-amino acid protein with the molecular mass of 59kD and 90kD cause of the posttranslational modifications including amidation, glycosylation, phosphorylation, and myristalation (PMID: 21737058). CCDC8 has 2 coiled-coil domains, and the proteins containing this domain are involved in diverse biological processes, such as the regulation of gene expression, cell division, and membrane fusion. CCDC8 is evolutionarily conserved, and CCDC8 mutation leads to the development of 3M syndrome in humans, a primordial growth disorder, by interacting with CUL7, OBSL1, and P53. Low-level or no expression of CCDC8 was shown to be closely related to the development of some tumors, such as renal cell carcinoma, multiple myeloma, breast cancer, and prostate cancer (PMID: 21737058, 27342910). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25794 Product name: Recombinant human CCDC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-196 aa of BC025243 Sequence: EKSTPHPPQPPKKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFLGSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWRE Predict reactive species Full Name: coiled-coil domain containing 8 Observed Molecular Weight: 90 kDa, 59 kDa GenBank Accession Number: BC025243 Gene Symbol: CCDC8 Gene ID (NCBI): 83987 RRID: AB_2880795 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0W5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.