Proteintech, 27205-1-AP, SUMO tag Polyclonal antibody

Size: 150ul The SUMO tag (27205-1-AP) by Proteintech is a Polyclonal antibody targeting SUMO tag in WB, ELISA applications with reactivity to recombinant protein samples 27205-1-AP targets SUMO tag in WB, ELISA applications and shows reactivity with recombinant protein samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information The SUMO tag (Small Ubiquitin-like Modifier) is a small protein approximately 100 amino acids in length (about 11 kDa). It is a member of the ubiquitin-like protein family and shares structural similarity with ubiquitin but has distinct functions. In the field of recombinant protein expression, the SUMO tag has been developed into a useful tool for enhancing protein solubility and expression levels. The SUMO tag is a highly efficient fusion tag with numerous advantages. It plays a significant role in recombinant protein expression, purification, and functional studies. Its applications continue to expand, contributing to advancements in life science research and biotechnology development. Specification Tested Reactivity: recombinant protein Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26104 Product name: Recombinant SUMO tag protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of Sequence: msdsevnqeakpevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedldmedndiieahreqiggs Predict reactive species Full Name: SUMO tag Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.