Iright
BRAND / VENDOR: Proteintech

Proteintech, 27206-1-AP, Huntingtin Polyclonal antibody

CATALOG NUMBER: 27206-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Huntingtin (27206-1-AP) by Proteintech is a Polyclonal antibody targeting Huntingtin in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 27206-1-AP targets Huntingtin in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human cerebellum tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat cerebellum tissue, mouse brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information HTT(huntingtin), also named HD and IT15, belongs to the huntingtin family. HTT may play a role in microtubule-mediated transport or vesicle function. Defects in HTT are the cause of Huntington's disease (HD) which is an autosomal dominant neurodegenerative disorder characterized by involuntary movements (chorea), general motor impairment, psychiatric disorders, and dementia. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25922 Product name: Recombinant human Huntingtin protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 2845-3000 aa of NM_002111 Sequence: LDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGE Predict reactive species Full Name: huntingtin Calculated Molecular Weight: 348 kDa GenBank Accession Number: NM_002111 Gene Symbol: Huntingtin Gene ID (NCBI): 3064 RRID: AB_2880799 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42858 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924