Iright
BRAND / VENDOR: Proteintech

Proteintech, 27224-1-AP, Integrin alpha-5/CD49e Polyclonal antibody

CATALOG NUMBER: 27224-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Integrin alpha-5/CD49e (27224-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-5/CD49e in WB, IHC, IP, ELISA applications with reactivity to human samples 27224-1-AP targets Integrin alpha-5/CD49e in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HAP1 cells, HeLa cells, human placenta tissue, U2OS cells Positive IP detected in: human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26098 Product name: Recombinant human ITGA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 874-995 aa of NM_002205 Sequence: PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY Predict reactive species Full Name: integrin, alpha 5 (fibronectin receptor, alpha polypeptide) Calculated Molecular Weight: 115 kDa Observed Molecular Weight: 135-150 kDa GenBank Accession Number: NM_002205 Gene Symbol: Integrin alpha 5 Gene ID (NCBI): 3678 RRID: AB_2880807 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08648 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924