Proteintech, 27225-1-AP, CACNA1E Polyclonal antibody

Size: 20ul / 150ul The CACNA1E (27225-1-AP) by Proteintech is a Polyclonal antibody targeting CACNA1E in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27225-1-AP targets CACNA1E in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CACNA1E is a gene encoding the ion-conducting α1 subunit of R-type voltage-dependent calcium channels, genetic variability of CACNA1E is associated to risk of type 2 diabetes, insulin resistance and impaired insulin secretion in nondiabetic subjects. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25944 Product name: Recombinant human CACNA1E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 801-900 aa of NM_000721 Sequence: MEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG Predict reactive species Full Name: calcium channel, voltage-dependent, R type, alpha 1E subunit Calculated Molecular Weight: 262 kDa Observed Molecular Weight: 240 kDa GenBank Accession Number: NM_000721 Gene Symbol: CACNA1E Gene ID (NCBI): 777 RRID: AB_2880808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15878 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.