Proteintech, 27227-1-AP, CACNA1A Polyclonal antibody

Size: 20ul / 150ul The CACNA1A (27227-1-AP) by Proteintech is a Polyclonal antibody targeting CACNA1A in IHC, ELISA applications with reactivity to human samples 27227-1-AP targets CACNA1A in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25943 Product name: Recombinant human CACNA1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 821-920 aa of NM_000068 Sequence: MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE Predict reactive species Full Name: calcium channel, voltage-dependent, P/Q type, alpha 1A subunit Calculated Molecular Weight: 282 kDa GenBank Accession Number: NM_000068 Gene Symbol: CACNA1A Gene ID (NCBI): 773 RRID: AB_2880810 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00555 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.