Proteintech, 27229-1-AP, ASXL2 Polyclonal antibody

Size: 20ul / 150ul The ASXL2 (27229-1-AP) by Proteintech is a Polyclonal antibody targeting ASXL2 in WB, ELISA applications with reactivity to human samples 27229-1-AP targets ASXL2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, Jurkat cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ASXL2 is an epigenetic regulator associated with various tumors including colorectal cancer, breast cancer, and myeloid leukemia. ASXL1, ASXL2 and ASXL3 are human homologs of Drosophila Asx (Additional sex combs) and function as epigenetic regulators through recruitment of Polycomb group repressor complexes (PRC) and Trithorax group activator complexes. ASXL proteins can interact with BAP1, NCOA1, EZH2, WTIP and nuclear receptors, which suggests diverse functions of ASXL family members in epigenetic and transcriptional regulation. (PMID: 30093396, PMID: 34692512) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24402 Product name: Recombinant human ASXL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 744-918 aa of BC042999 Sequence: LARDLIQAAQKQMAHAVRGKAIRSSPELFSSTVLPLPADSPTHQPLLLPPLQTPKLYGSPTQIGPSYRGMINVSTSSDMDHNSAVPGSQVSSNVGDVMSFSVTVTTIPASQAMNPSSHGQTIPVQAFSEENSIEGTPSKCYCRLKAMIMCKGCGAFCHDDCIGPSKLCVSCLVVR Predict reactive species Full Name: additional sex combs like 2 (Drosophila) Calculated Molecular Weight: 154 kDa Observed Molecular Weight: 154-230 kDa GenBank Accession Number: BC042999 Gene Symbol: ASXL2 Gene ID (NCBI): 55252 RRID: AB_3669589 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q76L83 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.