Iright
BRAND / VENDOR: Proteintech

Proteintech, 27235-1-AP, ASIC1 Polyclonal antibody

CATALOG NUMBER: 27235-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ASIC1 (27235-1-AP) by Proteintech is a Polyclonal antibody targeting ASIC1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 27235-1-AP targets ASIC1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human pancreas cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ASIC1(Acid-sensing ion channel 1), also named as ACCN2, BNaC2 or amiloride-sensitive cation channel 2, is a member of the ASICs family. ASICs, an H+-gated subgroup of the epithelial Na+ channel/degenerin (ENaC/DEG) superfamily, are widely expressed throughout the central and peripheral nervous system and triggered by increased extracellular acidification (PMID: 28518134, 27941930). ASIC1 is a key player in acidosis-induced tumor growth and invasiveness. Clinically, alterations of ASIC1 are associated with poor survival in breast cancer (PMID: 26686084). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25941 Product name: Recombinant human ASIC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 464-528 aa of NM_001095 Sequence: MKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC Predict reactive species Full Name: amiloride-sensitive cation channel 2, neuronal Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60-70 kDa, 80-90 kDa GenBank Accession Number: NM_001095 Gene Symbol: ASIC1 Gene ID (NCBI): 41 RRID: AB_2880814 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78348 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924