Iright
BRAND / VENDOR: Proteintech

Proteintech, 27239-1-AP, PELP1 Polyclonal antibody

CATALOG NUMBER: 27239-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PELP1 (27239-1-AP) by Proteintech is a Polyclonal antibody targeting PELP1 in IF/ICC, ELISA applications with reactivity to human samples 27239-1-AP targets PELP1 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PELP1 was first identified as a 160 kDa protein in a screen for Src homology 2 (SH2) domain-binding proteins. PELP1 is overexpressed in 60-80% of breast tumors and plays important roles in both ER genomic and non-genomic signaling. In vivo, PELP1 subcellular localization is primarily nuclear in normal breast tissue, but it is localized to the cytoplasm in about 40% of invasive breast tumors. In the nucleus, PELP1 interacts with a number of transcription factors. The proto-oncogenic functions of PELP1 involve different cellular processes including epigenetic modifications leading to ER transactivation and breast cancer progression. Furthermore, PELP1 activates kinase cascades in the cytoplasm such as MAPK activation via c-Src and PI3K signaling. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25729 Product name: Recombinant human PELP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 39-338 aa of BC069058 Sequence: ESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPV Predict reactive species Full Name: proline, glutamate and leucine rich protein 1 Calculated Molecular Weight: 1130 aa, 120 kDa GenBank Accession Number: BC069058 Gene Symbol: PELP1 Gene ID (NCBI): 27043 RRID: AB_2918120 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924