Proteintech, 27252-1-AP, EPDR1 Polyclonal antibody

Size: 20ul / 150ul The EPDR1 (27252-1-AP) by Proteintech is a Polyclonal antibody targeting EPDR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27252-1-AP targets EPDR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information The ependymin-related 1 (EPDR1) gene, also known as MERP1 and UCC1, encodes for a protein related to ependymins, which are type II transmembrane proteins that are similar to two families of cell adhesion molecules: the protocadherins and ependymins. Ependymin-related protein 1 (EPDR1) was recently identified as a secreted human batokine regulating mitochondrial respiration linked to thermogenesis in brown fat. Proteomics studies of mammalian mannose-6-phosphate (M6P) glycoproteins have identified EPDR1 as a lysosomal protein with unknown function. The lysosomal localization of EPDR1 was further demonstrated in mouse brain homogenates by subcellular fractionation.(PMID: 36343918, PMID: 33902536, PMID: 30729188) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26120 Product name: Recombinant human EPDR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-160 aa of BC018299 Sequence: QVMYQQSSGRNSRALLSYDGLNQRVRVLDERKALIPCKRLFEYILLYKDGVMFQIDQATKQCSKMTLTQPWDPLDIPQNSTFEDQYSIGGPQEQITVQEWSDRKSARSY Predict reactive species Full Name: Mammalian ependymin-related protein 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC018299 Gene Symbol: EPDR1 Gene ID (NCBI): 54749 RRID: AB_3085942 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UM22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.