Iright
BRAND / VENDOR: Proteintech

Proteintech, 27260-1-AP, Occludin Polyclonal antibody

CATALOG NUMBER: 27260-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Occludin (27260-1-AP) by Proteintech is a Polyclonal antibody targeting Occludin in WB, IHC, IF/ICC, IF-Fro, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 27260-1-AP targets Occludin in WB, IHC, IF/ICC, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, mouse kidney tissue, mouse brain tissue, mouse colon tissue, mouse liver tissue, rat liver tissue, rat brain tissue Positive IP detected in: HUVEC cells Positive IHC detected in: human colon tissue, human breast cancer tissue, human kidney tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-Fro detected in: mouse brain tissue Positive IF/ICC detected in: Caco-2 cells, MCF-7 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:10000 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, bovine, goat, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26173 Product name: Recombinant human Occludin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-522 aa of BC029886 Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species Full Name: occludin Calculated Molecular Weight: 522 aa, 59 kDa Observed Molecular Weight: 59 kDa, 53 kDa, 32 kDa, 23-25 kDa GenBank Accession Number: BC029886 Gene Symbol: Occludin Gene ID (NCBI): 4950 RRID: AB_2880820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924