Product Description
Size: 20ul / 150ul
The GNAQ (27264-1-AP) by Proteintech is a Polyclonal antibody targeting GNAQ in WB, ELISA applications with reactivity to human, mouse samples
27264-1-AP targets GNAQ in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: PC-12 cells, HepG2 cells, mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:3000
Background Information
GNAQ is a proto-oncogene closely related to the α subunit of guanine nucleotide-binding proteins (G proteins) that serve as key intermediates between membrane-bound G-protein-coupled receptors (GPCRs) and GPCR signalling nodes. Aberrant expression and activity of G proteins and GPCRs are frequently associated with tumorigenesis. Recent studies show that oncogenic activating mutations in GNAQ are present in 80% of the melanomas. The calculated molecular weight of GNAQ is 42 kDa. This antibody can detect a band of 38-40 kDa in SDS-PAGE. (PMID: 33993733)
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26170 Product name: Recombinant human GNAQ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 84-205 aa of BC057777 Sequence: FTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVD Predict reactive species
Full Name: guanine nucleotide binding protein (G protein), q polypeptide
Calculated Molecular Weight: 42 kDa
Observed Molecular Weight: 38-40 kDa
GenBank Accession Number: BC057777
Gene Symbol: GNAQ
Gene ID (NCBI): 2776
RRID: AB_2880822
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P50148
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924