Proteintech, 27270-1-AP, AS3MT Polyclonal antibody

Size: 20ul / 150ul The AS3MT (27270-1-AP) by Proteintech is a Polyclonal antibody targeting AS3MT in WB, ELISA applications with reactivity to human, mouse samples 27270-1-AP targets AS3MT in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26194 Product name: Recombinant human AS3MT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_020682 Sequence: MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTG Predict reactive species Full Name: arsenic (+3 oxidation state) methyltransferase Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 39-41 kDa GenBank Accession Number: NM_020682 Gene Symbol: AS3MT Gene ID (NCBI): 57412 RRID: AB_2880824 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBK9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.