Product Description
Size: 20ul / 150ul
The AS3MT (27270-1-AP) by Proteintech is a Polyclonal antibody targeting AS3MT in WB, ELISA applications with reactivity to human, mouse samples
27270-1-AP targets AS3MT in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse liver tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26194 Product name: Recombinant human AS3MT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_020682 Sequence: MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTG Predict reactive species
Full Name: arsenic (+3 oxidation state) methyltransferase
Calculated Molecular Weight: 42 kDa
Observed Molecular Weight: 39-41 kDa
GenBank Accession Number: NM_020682
Gene Symbol: AS3MT
Gene ID (NCBI): 57412
RRID: AB_2880824
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9HBK9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924