Proteintech, 27276-1-AP, KIF21A Polyclonal antibody

Size: 20ul / 150ul The KIF21A (27276-1-AP) by Proteintech is a Polyclonal antibody targeting KIF21A in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 27276-1-AP targets KIF21A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse brain tissue, MCF-7 Positive IP detected in: mouse brain tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KIF21A is well known for its association with congenital fibrosis of the extraocular muscles type 1 (CFEOM1). CFEOM1-related mutations in KIF21A relieve autoinhibition of the motor and third coiled-coil stalk, which results in enhanced accumulation of KIF21A in axonal growth cones and aberrant axon morphology in the oculomotor nerve.(PMID: 38767486) Specification Tested Reactivity: human, mouse Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26192 Product name: Recombinant human KIF21A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1125-1230 aa of NM_001173463 Sequence: MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL Predict reactive species Full Name: kinesin family member 21A Calculated Molecular Weight: 187 kDa Observed Molecular Weight: 190-200 kDa GenBank Accession Number: NM_001173463 Gene Symbol: KIF21A Gene ID (NCBI): 55605 RRID: AB_2880825 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z4S6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.