Iright
BRAND / VENDOR: Proteintech

Proteintech, 27285-1-AP, PPP1R3B Polyclonal antibody

CATALOG NUMBER: 27285-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP1R3B (27285-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R3B in WB, IHC, ELISA applications with reactivity to human, mouse samples 27285-1-AP targets PPP1R3B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, MDA-MB-453s cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PPP1R3B, also known as Protein Phosphatase 1, Regulatory Subunit 3B, is a protein encoded by the PPP1R3B gene in humans. It is a regulatory subunit of the serine/threonine-specific protein phosphatase 1 (PP1), an enzyme that plays a crucial role in the control of a wide range of cellular processes by dephosphorylating target proteins. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26025 Product name: Recombinant human PPP1R3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-259 aa of BC043388 Sequence: VLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQF Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 3B Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC043388 Gene Symbol: PPP1R3B Gene ID (NCBI): 79660 RRID: AB_2880829 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86XI6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924