Proteintech, 27286-1-AP, BCRP/ABCG2 Polyclonal antibody

Size: 20ul / 150ul The BCRP/ABCG2 (27286-1-AP) by Proteintech is a Polyclonal antibody targeting BCRP/ABCG2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27286-1-AP targets BCRP/ABCG2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, MCF-7 cells, SGC-7901 cells, mouse brain tissue Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25911 Product name: Recombinant human BCRP,ABCG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 557-630 aa of BC021281 Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH Predict reactive species Full Name: ATP-binding cassette, sub-family G (WHITE), member 2 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 68-72 kDa GenBank Accession Number: BC021281 Gene Symbol: ABCG2 Gene ID (NCBI): 9429 RRID: AB_2880830 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.