Iright
BRAND / VENDOR: Proteintech

Proteintech, 27292-1-AP, NRG4 Polyclonal antibody

CATALOG NUMBER: 27292-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NRG4 (27292-1-AP) by Proteintech is a Polyclonal antibody targeting NRG4 in IHC, ELISA applications with reactivity to human samples 27292-1-AP targets NRG4 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Neuregulin 4 (Nrg4), a member of the epidermal growth factor (EGF) family of extracellular ligands, is expressed in multiple organs with the highest expression levels in brown adipose tissue. Neuregulin 4 is a secreted adipokine recently identified as playing an important role in modulating systemic energy metabolism and in the development of metabolic disorders in rodent and human obesity, including type 2 diabetes and non-alcoholic fatty liver disease (NAFLD). Nrg4 attenuates hepatic lipogenic signaling and preserves glucose and lipid homeostasis in obesity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26044 Product name: Recombinant human NRG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC017568 Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF Predict reactive species Full Name: neuregulin 4 Calculated Molecular Weight: 13 kDa GenBank Accession Number: BC017568 Gene Symbol: NRG4 Gene ID (NCBI): 145957 RRID: AB_3669591 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924