Iright
BRAND / VENDOR: Proteintech

Proteintech, 27299-1-AP, GBP2 Polyclonal antibody

CATALOG NUMBER: 27299-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GBP2 (27299-1-AP) by Proteintech is a Polyclonal antibody targeting GBP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27299-1-AP targets GBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HeLa cells, mouse spleen tissue, rat spleen tissue Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25433 Product name: Recombinant human GBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 435-481 aa of BC022272 Sequence: TQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSLS Predict reactive species Full Name: guanylate binding protein 2, interferon-inducible Calculated Molecular Weight: 591 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC022272 Gene Symbol: GBP2 Gene ID (NCBI): 2634 RRID: AB_2880836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32456 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924