Proteintech, 27343-1-AP, SOCS6 Polyclonal antibody

Size: 20ul / 150ul The SOCS6 (27343-1-AP) by Proteintech is a Polyclonal antibody targeting SOCS6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 27343-1-AP targets SOCS6 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, NIH/3T3 cells, human placenta tissue Positive IP detected in: NIH/3T3 cells, human placenta tissue Positive IHC detected in: human colon tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SOCS6 (Suppressor of cytokine signaling 6) is also named as CIS4 and SOCS4. SOCS6 is one of eight members of the SOCS family of proteins. SOCS6 is involved in negative regulation of receptor signaling by increasing degradation mediated by ubiquitination of receptors or substrate proteins and induces apoptosis by targeting mitochondrial proteins (PMID: 25172101). SOCS6 is widely expressed in many tissues and is found to be downregulated in many cancers including colorectal cancer, gastric cancer, lung cancer, ovarian cancer, stomach cancer, thyroid cancer, hepatocellular carcinoma, and pancreatic cancer (PMID: 25172101). In addition to its molecular weight of 60 kDa, SOCS6 has a 70 kDa isoform (PMID: 34169835, PMID: 22125600). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25594 Product name: Recombinant human SOCS6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 132-385 aa of BC020082 Sequence: YSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY Predict reactive species Full Name: suppressor of cytokine signaling 6 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60-75 kDa GenBank Accession Number: BC020082 Gene Symbol: SOCS6 Gene ID (NCBI): 9306 RRID: AB_3669595 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14544 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.