Iright
BRAND / VENDOR: Proteintech

Proteintech, 27363-1-AP, CHI3L2 Polyclonal antibody

CATALOG NUMBER: 27363-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHI3L2 (27363-1-AP) by Proteintech is a Polyclonal antibody targeting CHI3L2 in WB, ELISA applications with reactivity to human samples 27363-1-AP targets CHI3L2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U-87 MG cells, NCCIT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CHI3L2 (Chitinase-3-Like Protein 2), also known as YKL-39, is a member of the chitinase-like protein family, which belongs to the glycoside hydrolase 18 family. CHI3L2 is primarily involved in cartilage biogenesis and tissue remodeling. It is highly expressed in certain tissues, including the appendix and salivary glands. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26386 Product name: Recombinant human CHI3L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-174 aa of BC011460 Sequence: SQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKST Predict reactive species Full Name: chitinase 3-like 2 Calculated Molecular Weight: 390 aa, 44 kDa Observed Molecular Weight: 44-48 kDa GenBank Accession Number: BC011460 Gene Symbol: CHI3L2 Gene ID (NCBI): 1117 RRID: AB_3669597 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15782 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924