Proteintech, 27377-1-AP, IL-2RG Polyclonal antibody

Size: 20ul / 150ul The IL-2RG (27377-1-AP) by Proteintech is a Polyclonal antibody targeting IL-2RG in WB, ELISA applications with reactivity to human samples 27377-1-AP targets IL-2RG in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The interleukin-2 receptor (IL-2R) is a heterotrimeric receptor consisting of three subunits, alpha (IL-2RA), beta (IL-2RB), and gamma (IL-2RG). IL-2RG, also known as CD132, is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in the gene of IL-2RG cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26388 Product name: Recombinant human IL-2RG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-262 aa of BC014972 Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEA Predict reactive species Full Name: interleukin 2 receptor, gamma (severe combined immunodeficiency) Calculated Molecular Weight: 369 aa, 42 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC014972 Gene Symbol: IL2RG Gene ID (NCBI): 3561 RRID: AB_2880857 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31785 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.