Proteintech, 27382-1-AP, C19orf12 Polyclonal antibody

Size: 20ul / 150ul The C19orf12 (27382-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf12 in WB, IHC, ELISA applications with reactivity to human samples 27382-1-AP targets C19orf12 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:150-1:600 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26555 Product name: Recombinant human C19orf12 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-107 aa of BC063518 Sequence: MTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRPCSSSCWPCW Predict reactive species Full Name: chromosome 19 open reading frame 12 Calculated Molecular Weight: 107 aa, 11 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC063518 Gene Symbol: C19orf12 Gene ID (NCBI): 83636 RRID: AB_2880858 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NSK7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.