Proteintech, 27403-1-AP, RAB5B Polyclonal antibody

Size: 20ul / 150ul The RAB5B (27403-1-AP) by Proteintech is a Polyclonal antibody targeting RAB5B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27403-1-AP targets RAB5B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, mouse lung tissue, rat lung tissue Positive IHC detected in: human stomach tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26584 Product name: Recombinant human RAB5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-215 aa of BC032740 Sequence: GNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN Predict reactive species Full Name: RAB5B, member RAS oncogene family Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC032740 Gene Symbol: RAB5B Gene ID (NCBI): 5869 RRID: AB_2880862 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61020 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.