Iright
BRAND / VENDOR: Proteintech

Proteintech, 27428-1-AP, B7-H6 Polyclonal antibody

CATALOG NUMBER: 27428-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The B7-H6 (27428-1-AP) by Proteintech is a Polyclonal antibody targeting B7-H6 in WB, ELISA applications with reactivity to human samples 27428-1-AP targets B7-H6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information B7-H6, also known as NCR3LG1, is a member of the B7 family of immunoreceptors. It is a 454-aa-long type I transmembrane protein consisting of an extracellular region, a transmembrane segment, and a cytoplasmic domain which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM), an SH2-binding domain, and an SH3-binding motif. B7-H6 triggers NKp30-mediated activation of human NK cells (PMID: 19528259). It has been reported that B7H6 is expressed in various types of tumor cells and plays a prominent role in natural killer cell immunosurveillance (PMID: 35697295). The apparent molecular weight of B7-H6 is larger than the calculated molecular weight of 51 kDa due to glycosylation (PMID: 19528259). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26532 Product name: Recombinant human DKFZp686O24166 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-259 aa of BC136800 Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTD Predict reactive species Full Name: hypothetical protein DKFZp686O24166 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: BC136800 Gene Symbol: B7H6 Gene ID (NCBI): 374383 RRID: AB_3085956 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q68D85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924