Proteintech, 27431-1-AP, BRAP Polyclonal antibody

Size: 20ul / 150ul The BRAP (27431-1-AP) by Proteintech is a Polyclonal antibody targeting BRAP in WB, IP, IHC, ELISA applications with reactivity to human samples 27431-1-AP targets BRAP in WB, IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, A431 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26728 Product name: Recombinant human BRAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 376-535 aa of BC136698 Sequence: RLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRD Predict reactive species Full Name: BRCA1 associated protein Calculated Molecular Weight: 592 aa, 67 kDa Observed Molecular Weight: 62-70 kDa, 48 kDa GenBank Accession Number: BC136698 Gene Symbol: BRAP Gene ID (NCBI): 8315 RRID: AB_2880869 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z569 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.