Iright
BRAND / VENDOR: Proteintech

Proteintech, 27441-1-AP, CCL3/MIP-1 alpha Polyclonal antibody

CATALOG NUMBER: 27441-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCL3/MIP-1 alpha (27441-1-AP) by Proteintech is a Polyclonal antibody targeting CCL3/MIP-1 alpha in WB, ELISA applications with reactivity to human samples 27441-1-AP targets CCL3/MIP-1 alpha in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Chemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26764 Product name: Recombinant human CCL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC071834 Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA Predict reactive species Full Name: chemokine (C-C motif) ligand 3 Calculated Molecular Weight: 92 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC071834 Gene Symbol: CCL3/MIP-1 alpha Gene ID (NCBI): 6348 RRID: AB_3085961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10147 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924