Proteintech, 27461-1-AP, HSD17B12 Polyclonal antibody

Size: 20ul / 150ul The HSD17B12 (27461-1-AP) by Proteintech is a Polyclonal antibody targeting HSD17B12 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 27461-1-AP targets HSD17B12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, HCT 116 cells, HEK-293 cells, HT-29 cells, U-251 cells Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Hydroxysteroid 17-beta dehydrogenase 12 (HSD17B12, also known as KAR and SDR12C1) is a key enzyme of steroid metabolism pathway19 and is the human homolog of the yeast 3-ketoacyl-CoA reductase that catalyzes the second reaction in each VLCFA elongation cycle (PMID: 16166196; 12482854). It also acts as a drug-metabolizing enzyme (PMID: 36724833). HSD17B12 deficiency in embryonic stem cells reduced the production of arachidonic acid, a precursor of prostaglandins (PMID: 20130115). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26540 Product name: Recombinant human HSD17B12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-271 aa of BC012043 Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG Predict reactive species Full Name: hydroxysteroid (17-beta) dehydrogenase 12 Calculated Molecular Weight: 312 aa, 34 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012043 Gene Symbol: HSD17B12 Gene ID (NCBI): 51144 RRID: AB_3669604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53GQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.