Iright
BRAND / VENDOR: Proteintech

Proteintech, 27472-1-AP, PEX26 Polyclonal antibody

CATALOG NUMBER: 27472-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PEX26 (27472-1-AP) by Proteintech is a Polyclonal antibody targeting PEX26 in WB, ELISA applications with reactivity to human samples 27472-1-AP targets PEX26 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26529 Product name: Recombinant human PEX26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC016280 Sequence: MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSH Predict reactive species Full Name: peroxisomal biogenesis factor 26 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC016280 Gene Symbol: PEX26 Gene ID (NCBI): 55670 RRID: AB_2880881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z412 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924