Proteintech, 27493-1-AP, DHTKD1 Polyclonal antibody

Size: 20ul / 150ul The DHTKD1 (27493-1-AP) by Proteintech is a Polyclonal antibody targeting DHTKD1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 27493-1-AP targets DHTKD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HepG2 cells, PC-13 cells, L02 cells, mouse kidney tissue, mouse liver tissue, rat liver tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26515 Product name: Recombinant human DHTKD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-197 aa of BC007955 Sequence: GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES Predict reactive species Full Name: dehydrogenase E1 and transketolase domain containing 1 Calculated Molecular Weight: 103 kDa Observed Molecular Weight: 103 kDa GenBank Accession Number: BC007955 Gene Symbol: DHTKD1 Gene ID (NCBI): 55526 RRID: AB_2880888 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96HY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.