Product Description
Size: 20ul / 150ul
The CLUL1 (27498-1-AP) by Proteintech is a Polyclonal antibody targeting CLUL1 in WB, ELISA applications with reactivity to human samples
27498-1-AP targets CLUL1 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: ARPE-19 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
Clusterin-like protein 1 (CLUL1) functions as a molecular chaperone, protecting stressed proteins, and is upregulated in various neurodegenerative conditions, suggesting a role in defense against neuronal damage (PMID: 17148042). It is specifically expressed in cone photoreceptor cells and is regulated by the cone-rod homeobox (CRX) (PMID: 14507903). Mutations of CLUL1 were investigated in the context of age-related macular degeneration (AMD), a leading cause of blindness in the elderly (PMID: 17148042).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26570 Product name: Recombinant human CLUL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-124 aa of BC025381 Sequence: APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNC Predict reactive species
Full Name: clusterin-like 1 (retinal)
Calculated Molecular Weight: 54 kDa
Observed Molecular Weight: 70 kDa
GenBank Accession Number: BC025381
Gene Symbol: CLUL1
Gene ID (NCBI): 27098
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q15846
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924