Proteintech, 27501-1-AP, MOCS3 Polyclonal antibody

Size: 20ul / 150ul The MOCS3 (27501-1-AP) by Proteintech is a Polyclonal antibody targeting MOCS3 in WB, IHC, ELISA applications with reactivity to Human samples 27501-1-AP targets MOCS3 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells Positive IHC detected in: human liver cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MOCS3, also named as molybdenum cofactor synthesis 3 and UBA4. The human MOCS3 protein contains an N-terminal domain similar to the Escherichia coli MoeB protein and a C-terminal segment displaying similarities to the sulfurtransferase rhodanese. MOCS3 is proposed to catalyze both the adenylation and the subsequent generation of a thiocarboxylate group at the C-terminus of the smaller subunit of molybdopterin (MPT) synthase during Moco biosynthesis in humans (PMID: 15910006). MOCS3 has a calculated molecular weight of 50 kDa and can be detected another band of 65 kDa due to urmylation (PMID: 21209336). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26596 Product name: Recombinant human MOCS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 279-404 aa of BC015939 Sequence: DALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGA Predict reactive species Full Name: molybdenum cofactor synthesis 3 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa, 65 kDa GenBank Accession Number: BC015939 Gene Symbol: MOCS3 Gene ID (NCBI): 27304 RRID: AB_2880892 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95396 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.