Product Description
Size: 20ul / 150ul
The BEX4 (27525-1-AP) by Proteintech is a Polyclonal antibody targeting BEX4 in WB, ELISA applications with reactivity to human samples
27525-1-AP targets BEX4 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HL-60 cells, K-562 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
BEX4, also known as BEXL1 and NADE3, which belongs to the BEX family. The brain-expressed X-linked (BEX) family consists of five member genes (from 1 to 5) that are commonly located on the X chromosome. The molecular weight of BEXs is approximately 15 kDa, but little is known about their structural characteristics and molecular functions (PMID: 34576008).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26207 Product name: Recombinant human BEX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC015794 Sequence: MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP Predict reactive species
Full Name: brain expressed, X-linked 4
Calculated Molecular Weight: 120 aa, 14 kDa
Observed Molecular Weight: 18-20 kDa
GenBank Accession Number: BC015794
Gene Symbol: BEX4
Gene ID (NCBI): 56271
RRID: AB_3669608
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NWD9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924