Product Description
Size: 20ul / 150ul
The ADAM32 (27530-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM32 in WB, ELISA applications with reactivity to human, mouse, rat samples
27530-1-AP targets ADAM32 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse testis tissue, rat testis tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
ADAM32 may play a role in sperm development and fertilization and it is a non-catalytic metalloprotease-like protein. In mature sperm from cauda epididymis and vas deferens, a band of 44 kDa for ADAM32 is detected and indicates that ADAM32 is made as precursors and processed to lower molecular-weight forms during sperm maturation in the epididymis(PMID:16407499). The full length protein has a signal peptide, a propeptide and 4 glycosylation sites.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26450 Product name: Recombinant human ADAM32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 704-787 aa of BC026169 Sequence: RKQLKKWFAKEEEFPSSESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDSTQTQSSSN Predict reactive species
Full Name: ADAM metallopeptidase domain 32
Calculated Molecular Weight: 787 aa, 88 kDa
Observed Molecular Weight: 80 kDa
GenBank Accession Number: BC026169
Gene Symbol: ADAM32
Gene ID (NCBI): 203102
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8TC27
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924