Iright
BRAND / VENDOR: Proteintech

Proteintech, 27538-1-AP, Cathepsin S Polyclonal antibody

CATALOG NUMBER: 27538-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cathepsin S (27538-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin S in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 27538-1-AP targets Cathepsin S in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, THP-1 cells, U-87 MG cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cathepsin S (CTSS) is a cysteine protease that plays an important role in extracellular matrix degradation and remodeling, antigen presentation, inflammation, and angiogenesis; it has been identified as a radiation response gene. In malignant tumors, CTSS induces tumor proliferation, invasion and metastasis through various mechanisms. CTSS proteins could be detected in two forms, pro-CTSS (35-37 kDa) and active CTSS (25 kDa) (PMID: 30006610, PMID: 34208434). And in this publication, it was also reporeted that active CTSS was expressed at higher levels than pro-CTSS in the lysate (PMID: 34208434). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25881 Product name: Recombinant human CTSS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 179-296 aa of BC002642 Sequence: GCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLV Predict reactive species Full Name: cathepsin S Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 25 kDa, 37 kDa GenBank Accession Number: BC002642 Gene Symbol: CTSS Gene ID (NCBI): 1520 RRID: AB_3085966 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25774 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924