Proteintech, 27543-1-AP, Livin Polyclonal antibody

Size: 20ul / 150ul The Livin (27543-1-AP) by Proteintech is a Polyclonal antibody targeting Livin in WB, IHC, ELISA applications with reactivity to Human samples 27543-1-AP targets Livin in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Jurkat cells, A431 cells, A375 cells, HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BIRC7 also known as Livin, is one of the family members of the inhibitor of apoptosis protein (IAP). BIRC7 contains a BIR domain that has been shown to bind and inhibit caspases-3, −7 and −9, playing a key role in inhibiting apoptosis. Overexpression of BIRC7 in tumors has been linked with increased chemo- and radio-resistance, recurrence, and decreased patient survival. BIRC7 is closely associated with melanoma disease progression, apoptosis resistance, and chemotherapeutic drug resistance. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26737 Product name: Recombinant human BIRC7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-216 aa of BC014475 Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEP Predict reactive species Full Name: baculoviral IAP repeat-containing 7 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC014475 Gene Symbol: Livin Gene ID (NCBI): 79444 RRID: AB_2880901 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CA5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.