Iright
BRAND / VENDOR: Proteintech

Proteintech, 27550-1-AP, EMC7/C15orf24 Polyclonal antibody

CATALOG NUMBER: 27550-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EMC7/C15orf24 (27550-1-AP) by Proteintech is a Polyclonal antibody targeting EMC7/C15orf24 in WB, IHC, ELISA applications with reactivity to human samples 27550-1-AP targets EMC7/C15orf24 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26784 Product name: Recombinant human C15orf24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-159 aa of BC104934 Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD Predict reactive species Full Name: chromosome 15 open reading frame 24 Observed Molecular Weight: 20-26 kDa GenBank Accession Number: BC104934 Gene Symbol: EMC7 Gene ID (NCBI): 56851 RRID: AB_2880902 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924