Proteintech, 27551-1-AP, SCN2A Polyclonal antibody

Size: 20ul / 150ul The SCN2A (27551-1-AP) by Proteintech is a Polyclonal antibody targeting SCN2A in WB, IF-P, ELISA applications with reactivity to human, mouse samples 27551-1-AP targets SCN2A in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, mouse heart tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The Sodium Channel, Voltage-Gated, Type II, Alpha (SCN2A) gene encodes the neuronal sodium channel NaV1.2. There are two major developmentally regulated splice isoforms of NaV1.2 that use mutually exclusive copies of the fifth coding exon and differ by one amino acid at position 209: Asparagine (Asn/N) vs. Aspartic acid (Asp/D). NaV1.2 is one of several sodium channels involved in initiation and propagation of action potentials in neurons. It's widely expressed throughout the human central nervous system, but not in peripheral tissues. (PMID: 29691040) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26022 Product name: Recombinant human SCN2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-335 aa of NM_001040142 Sequence: MQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDA Predict reactive species Full Name: sodium channel, voltage-gated, type II, alpha subunit Calculated Molecular Weight: 228 kDa Observed Molecular Weight: ~250 kDa GenBank Accession Number: NM_001040142 Gene Symbol: SCN2A Gene ID (NCBI): 6326 RRID: AB_3085969 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99250 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.