Product Description
Size: 20ul / 150ul
The CD64 (27563-1-AP) by Proteintech is a Polyclonal antibody targeting CD64 in WB, IF/ICC, ELISA applications with reactivity to human samples
27563-1-AP targets CD64 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: THP-1 cells, U-937 cells, HL-60 cells
Positive IF/ICC detected in: THP-1 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Fcγ receptor comprise a multigene family of integral membrane glycoproteins that exhibit complex activation or inhibitory effects on cell functions after aggregation by complexed immunoglobulin G (IgG) (PMID: 17005690 ). CD64, also known as FcγRIA, is a high affinity receptor for the Fc region of IgG. It is expressed by monocytes/macrophages, activated neutrophils, dendritic cells, and early myeloid cells (PMID: 23293080; 19642859; 7680917). CD64 functions in both innate and adaptive immune responses. The calculated molecular weight of CD64 is 43 kDa, while the glycosylated CD64 has a higher apparent molecular weight.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26727 Product name: Recombinant human FCGR1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-374 aa of BC032634 Sequence: VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT Predict reactive species
Full Name: Fc fragment of IgG, high affinity Ia, receptor (CD64)
Calculated Molecular Weight: 374 aa, 43 kDa
Observed Molecular Weight: 65-70 kDa, 43-45 kDa
GenBank Accession Number: BC032634
Gene Symbol: FCGR1A
Gene ID (NCBI): 2209
ENSEMBL Gene ID: ENSG00000150337
RRID: AB_2880909
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P12314
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924