Proteintech, 27569-1-AP, C1GALT1 Polyclonal antibody

Size: 20ul / 150ul The C1GALT1 (27569-1-AP) by Proteintech is a Polyclonal antibody targeting C1GALT1 in WB, IF/ICC, ELISA applications with reactivity to human samples 27569-1-AP targets C1GALT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MKN-45 cells, HepG2 cells, T-47D cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1), also known as B3Gal-T8, catalyzes the transfer of galactose (Gal) from UDP-Gal to N-acetylgalactosamine (GalNAc) O-linked esters of threonine and serine residues of target proteins, including IgA1, to form the T antigen (PMID: 28209808). C1GalT1 is overexpressed in many common cancers includingcolon, breast, gastric, lung, head and neck, pancreatic, esophageal, prostate, and hepatocellular cancer (PMID: 34944925). C1GALT1 protein contains 363 amino acids and is a typeII transmembrane protein. Rate C1GalT1 is an 84/86KDa disulfide-bonded homodimer, but its active form is believed to be a 42/43 KDa monomeric protein (PMID: 34149900). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26144 Product name: Recombinant human C1GALT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 263-363 aa of NM_020156 Sequence: MKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP Predict reactive species Full Name: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: NM_020156 Gene Symbol: C1GALT1 Gene ID (NCBI): 56913 RRID: AB_2880912 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS00 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.